PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN16908.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 218aa    MW: 24343.2 Da    PI: 7.6286
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN16908.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.49.4e-201562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEdell+++++++G g+Wk+I++  g+ R++k+c++rw +yl
       KHN16908.1 15 KGPWSKEEDELLINYINLHGQGNWKSIPKAAGLLRCGKSCRLRWTNYL 62
                     79******************************99************97 PP

2Myb_DNA-binding513.4e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g++T+eE  l+++++ +lG++ W+ Ia  ++ gRt++++k++w ++l
       KHN16908.1  68 KGNFTEEESNLIIHLHSLLGNK-WSQIATSLP-GRTDNEIKNYWKSHL 113
                      79********************.*********.***********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.341062IPR017930Myb domain
SuperFamilySSF466893.34E-3114109IPR009057Homeodomain-like
SMARTSM007179.4E-171464IPR001005SANT/Myb domain
PfamPF002494.3E-181562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-251669IPR009057Homeodomain-like
CDDcd001673.58E-141762No hitNo description
PROSITE profilePS5129426.28963117IPR017930Myb domain
SMARTSM007178.2E-1667115IPR001005SANT/Myb domain
PfamPF002494.2E-1568113IPR001005SANT/Myb domain
CDDcd001675.94E-1270113No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2670116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MGRTPCSDKE QINKKGPWSK EEDELLINYI NLHGQGNWKS IPKAAGLLRC GKSCRLRWTN  60
YLRPDLKKGN FTEEESNLII HLHSLLGNKW SQIATSLPGR TDNEIKNYWK SHLKRYLYAL  120
GIDPVTHKPF KEDTNTTSTP PNNSMATTTS TIPRIYYFNV FLNSKVHISA DDDYSADGGA  180
DSNSSSGVTI EEASPQVNLE LSIAPPSQPH EDAASVKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29151177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003532377.11e-163PREDICTED: myb-related protein 330-like
SwissprotQ9SZP13e-70MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A0B2QA491e-163A0A0B2QA49_GLYSO; Transcription repressor MYB4
TrEMBLK7L4951e-163K7L495_SOYBN; Uncharacterized protein
STRINGGLYMA08G00810.21e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.18e-69myb domain protein 7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]